PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS71953.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MYB_related
Protein Properties Length: 657aa    MW: 74397.4 Da    PI: 7.8158
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS71953.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding22.72.3e-071053348
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +WT +E+e +  a +q G++ +++I  +++  +   q++++++ +l
       EPS71953.1 10 AWTRQEEESFFSALRQVGKN-FDKITCRVQ-SKNKDQVRHYYYRLL 53
                     6*****************99.*********.************886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.29E-9557IPR009057Homeodomain-like
PROSITE profilePS5129311.984657IPR017884SANT domain
SMARTSM007178.3E-5755IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.1E-5755IPR009057Homeodomain-like
PfamPF002491.6E-51053IPR001005SANT/Myb domain
CDDcd001671.91E-41053No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 657 aa     Download sequence    Send to blast
VKKQTRRWAA WTRQEEESFF SALRQVGKNF DKITCRVQSK NKDQVRHYYY RLLRRMNKLL  60
DPDLCLNAKN SKYTNTAMLR WWSLLEKYSC KASKLHLKPR RFKIFVENLE NQLLRDRKKS  120
MKRRVSSGEN NSSFHNIPSS DQIKSSGHDC RAIKVVLESQ NVNNKVGKTS NRRWKRGDLH  180
TFTAYKRWEK AAIAGVSLVA DAAEHLERVD TDKEIENSLD GSRHGPAVAP QRVASPPYNI  240
FKESVHSHAK IKLQLFPVDE RTRRILEVEN HNPHLELTLS TRKKISSVLE HLNRKWRNTS  300
FQSRDLVLFP FWVQGENLLG YQKWTKESPF CAADVYCLVG SPATFRLRYG WFSRDEMNSG  360
PAQLSSQMDP NDERAKTCSS SEAANTLILT STSRPCESLN LPVFEQNSSG GLNDETALIH  420
GRDISHISVV EHNENMVYLA YSFLLSAGEW ANTLTDDVTL RDLLSGSGSL PNMDTDPAPL  480
ISNGVHHQML LPFSCDSFDA AIAAHIYKHQ NRTGGSEPGN APPSSSSIWE AEETRDAFSF  540
QKPVVLRVDD DRDKAAASST SYHTGELPAD VDENLTRNDD NLFGDHNLAG STKDLGGLTD  600
IYWPESLGPL ELDVAPAACR YSTDLILSDS LSGFNWLVAN SLDAFQNWSF FGFDKKE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011077326.10.0PREDICTED: TSL-kinase interacting protein 1
SwissprotQ8LJT81e-180TKI1_ARATH; TSL-kinase interacting protein 1
TrEMBLS8E7Y30.0S8E7Y3_9LAMI; Uncharacterized protein (Fragment)
STRINGVIT_08s0040g01460.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA86401719
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36960.21e-177TSL-kinase interacting protein 1
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]